Loading...
Statistics
Advertisement

Stajnia koło Warszawy, Pensjonat dla koni koło Warszawy, boksy dla ...
www.stajnia-aleksandria.pl/

Stajnia-aleksandria.pl

Advertisement
Conversion Technology Metas Server
Stajnia-aleksandria.pl is hosted in Poland . Stajnia-aleksandria.pl doesn't use HTTPS protocol. Number of used technologies: 5. First technologies: CSS, Html, Javascript, Number of used javascripts: 6. First javascripts: Mootools-core.js, Mootools-more.js, Flowplayer-3.1.0.min.js, Number of used analytics tools: 1. First analytics tools: Google Analytics, Number of used plugins, modules: 1. Its server type is: Apache/2.4.

Technologies in use by Stajnia-aleksandria.pl

Technology

Number of occurences: 5
  • CSS
  • Html
  • Javascript
  • Php
  • Swf Object

Advertisement

Javascripts

Number of occurences: 6
  • mootools-core.js
  • mootools-more.js
  • flowplayer-3.1.0.min.js
  • cufon-yui.js
  • font.js
  • slimbox.js

Analytics

Number of occurences: 1
  • Google Analytics

Server Type

  • Apache/2.4

Social

Number of occurences: 1
  • Facebook Box

Used plugins, modules

Number of plugins and modules: 1
  • ch flowplayer

Conversion rate optimization
visitors Clickable call number Not founded!
visitors Conversion form (contact form, subcriber) Not founded!
visitors Clickable email Not founded!
visitors CTA (call to action) button Not founded!
visitors List Founded!
visitors Image Not founded!
visitors Enhancement Not founded!
visitors Responsive website Not founded!
visitors Facebook sharing Not founded!
visitors Google+ sharing Not founded!
visitors Twitter sharing Not founded!
visitors Linkedin sharing Not founded!
visitors Blog on the webiste Not founded!

HTTPS (SSL) - Stajnia-aleksandria.pl

Missing HTTPS protocol.

    Meta - Stajnia-aleksandria.pl

    Number of occurences: 4
    • Name:
      Content: text/html; charset=utf-8
    • Name: description
      Content:
    • Name: keywords
      Content: boksy dla koni koło warszawy
    • Name: robots
      Content: index,follow

    Server / Hosting

    • IP: 86.111.242.5
    • Latitude: 52.24
    • Longitude: 21.04
    • Country: Poland

    Rname

    • ns2.iq.pl
    • ns1.iq.pl
    • mx1.iq.pl
    • mail.iq.pl

    Target

    • dns.iq.pl

    HTTP Header Response

    HTTP/1.1 200 OK Date: Fri, 15 Apr 2016 09:59:46 GMT Server: Apache/2.4 Cache-Control: no-cache, pre-check=0, post-check=0 Expires: Wed, 28 Jan 1976 11:52:00 GMT Pragma: no-cache Set-Cookie: PHPSESSID=c1dfa33906c516a4613339f07e72ed53; path=/ Last-Modified: Fri, 15 Apr 2016 09:59:46 GMT Content-Type: text/html; charset=UTF-8

    DNS

    host: stajnia-aleksandria.pl
    1. class: IN
    2. ttl: 10800
    3. type: A
    4. ip: 86.111.242.5
    host: stajnia-aleksandria.pl
    1. class: IN
    2. ttl: 10800
    3. type: NS
    4. target: ns2.iq.pl
    host: stajnia-aleksandria.pl
    1. class: IN
    2. ttl: 10800
    3. type: NS
    4. target: ns1.iq.pl
    host: stajnia-aleksandria.pl
    1. class: IN
    2. ttl: 10800
    3. type: SOA
    4. mname: ns1.iq.pl
    5. rname: dns.iq.pl
    6. serial: 2009102118
    7. refresh: 10800
    8. retry: 3600
    9. expire: 604800
    10. minimum-ttl: 3600
    host: stajnia-aleksandria.pl
    1. class: IN
    2. ttl: 10800
    3. type: MX
    4. pri: 1
    5. target: mx1.iq.pl
    host: stajnia-aleksandria.pl
    1. class: IN
    2. ttl: 10800
    3. type: MX
    4. pri: 5
    5. target: mail.iq.pl
    host: stajnia-aleksandria.pl
    1. class: IN
    2. ttl: 10800
    3. type: TXT
    4. txt: v=spf1 a mx ptr ip4:86.111.240.0/21 -all
    5. entries: Array

    Common Typos/Mistakes

    This list shows You some spelling mistakes at internet search for this domain.

    www.tajnia-aleksandria.pl, www.setajnia-aleksandria.pl, www.etajnia-aleksandria.pl, www.swtajnia-aleksandria.pl, www.wtajnia-aleksandria.pl, www.sdtajnia-aleksandria.pl, www.dtajnia-aleksandria.pl, www.sxtajnia-aleksandria.pl, www.xtajnia-aleksandria.pl, www.sftajnia-aleksandria.pl, www.ftajnia-aleksandria.pl, www.sgtajnia-aleksandria.pl, www.gtajnia-aleksandria.pl, www.sttajnia-aleksandria.pl, www.ttajnia-aleksandria.pl, www.sajnia-aleksandria.pl, www.stqajnia-aleksandria.pl, www.sqajnia-aleksandria.pl, www.staajnia-aleksandria.pl, www.saajnia-aleksandria.pl, www.st ajnia-aleksandria.pl, www.s ajnia-aleksandria.pl, www.stwajnia-aleksandria.pl, www.swajnia-aleksandria.pl, www.steajnia-aleksandria.pl, www.seajnia-aleksandria.pl, www.stzajnia-aleksandria.pl, www.szajnia-aleksandria.pl, www.stxajnia-aleksandria.pl, www.sxajnia-aleksandria.pl, www.stcajnia-aleksandria.pl, www.scajnia-aleksandria.pl, www.stjnia-aleksandria.pl, www.staojnia-aleksandria.pl, www.stojnia-aleksandria.pl, www.stapjnia-aleksandria.pl, www.stpjnia-aleksandria.pl, www.sta9jnia-aleksandria.pl, www.st9jnia-aleksandria.pl, www.stajnia-aleksandria.pl, www.stjnia-aleksandria.pl, www.staijnia-aleksandria.pl, www.stijnia-aleksandria.pl, www.staujnia-aleksandria.pl, www.stujnia-aleksandria.pl, www.stania-aleksandria.pl, www.stajznia-aleksandria.pl, www.staznia-aleksandria.pl, www.stajhnia-aleksandria.pl, www.stahnia-aleksandria.pl, www.stajnnia-aleksandria.pl, www.stannia-aleksandria.pl, www.staj.nia-aleksandria.pl, www.sta.nia-aleksandria.pl, www.stajunia-aleksandria.pl, www.staunia-aleksandria.pl, www.stajknia-aleksandria.pl, www.staknia-aleksandria.pl, www.stajlnia-aleksandria.pl, www.stalnia-aleksandria.pl, www.stajonia-aleksandria.pl, www.staonia-aleksandria.pl, www.stajia-aleksandria.pl, www.stajnnia-aleksandria.pl, www.stajnia-aleksandria.pl, www.stajnhia-aleksandria.pl, www.stajhia-aleksandria.pl, www.stajnjia-aleksandria.pl, www.stajjia-aleksandria.pl, www.stajnkia-aleksandria.pl, www.stajkia-aleksandria.pl, www.stajnlia-aleksandria.pl, www.stajlia-aleksandria.pl, www.stajn ia-aleksandria.pl, www.staj ia-aleksandria.pl, www.stajna-aleksandria.pl, www.stajnira-aleksandria.pl, www.stajnra-aleksandria.pl, www.stajnifa-aleksandria.pl, www.stajnfa-aleksandria.pl, www.stajniva-aleksandria.pl, www.stajnva-aleksandria.pl, www.stajnika-aleksandria.pl, www.stajnka-aleksandria.pl, www.stajni,a-aleksandria.pl, www.stajn,a-aleksandria.pl, www.stajniba-aleksandria.pl, www.stajnba-aleksandria.pl, www.stajniga-aleksandria.pl, www.stajnga-aleksandria.pl, www.stajnita-aleksandria.pl, www.stajnta-aleksandria.pl, www.stajniya-aleksandria.pl, www.stajnya-aleksandria.pl, www.stajniua-aleksandria.pl, www.stajnua-aleksandria.pl, www.stajnija-aleksandria.pl, www.stajnja-aleksandria.pl, www.stajnima-aleksandria.pl, www.stajnma-aleksandria.pl, www.stajnina-aleksandria.pl, www.stajnna-aleksandria.pl, www.stajni-aleksandria.pl, www.stajniao-aleksandria.pl, www.stajnio-aleksandria.pl, www.stajniap-aleksandria.pl, www.stajnip-aleksandria.pl, www.stajnia9-aleksandria.pl, www.stajni9-aleksandria.pl, www.stajnia-aleksandria.pl, www.stajni-aleksandria.pl, www.stajniai-aleksandria.pl, www.stajnii-aleksandria.pl, www.stajniau-aleksandria.pl, www.stajniu-aleksandria.pl, www.stajniaaleksandria.pl, www.stajnia-taleksandria.pl, www.stajniataleksandria.pl, www.stajnia-galeksandria.pl, www.stajniagaleksandria.pl, www.stajnia-haleksandria.pl, www.stajniahaleksandria.pl, www.stajnia-ualeksandria.pl, www.stajniaualeksandria.pl, www.stajnia-jaleksandria.pl, www.stajniajaleksandria.pl, www.stajnia-xaleksandria.pl, www.stajniaxaleksandria.pl, www.stajnia-saleksandria.pl, www.stajniasaleksandria.pl, www.stajnia-aaleksandria.pl, www.stajniaaaleksandria.pl, www.stajnia-aleksandria.pl, www.stajniaaleksandria.pl, www.stajnia- aleksandria.pl, www.stajnia aleksandria.pl, www.stajnia-leksandria.pl, www.stajnia-aoleksandria.pl, www.stajnia-oleksandria.pl, www.stajnia-apleksandria.pl, www.stajnia-pleksandria.pl, www.stajnia-a9leksandria.pl, www.stajnia-9leksandria.pl, www.stajnia-aleksandria.pl, www.stajnia-leksandria.pl, www.stajnia-aileksandria.pl, www.stajnia-ileksandria.pl, www.stajnia-auleksandria.pl, www.stajnia-uleksandria.pl, www.stajnia-aeksandria.pl, www.stajnia-alueksandria.pl, www.stajnia-aueksandria.pl, www.stajnia-al8eksandria.pl, www.stajnia-a8eksandria.pl, www.stajnia-al9eksandria.pl, www.stajnia-a9eksandria.pl, www.stajnia-aljeksandria.pl, www.stajnia-ajeksandria.pl, www.stajnia-al0eksandria.pl, www.stajnia-a0eksandria.pl, www.stajnia-almeksandria.pl, www.stajnia-ameksandria.pl, www.stajnia-alpeksandria.pl, www.stajnia-apeksandria.pl, www.stajnia-aloeksandria.pl, www.stajnia-aoeksandria.pl,

    Other websites we recently analyzed

    1. Home - Charles Galloway Photography
      United Kingdom - 79.170.40.54
      Server software: Apache/2.4.18 (Unix)
      Technology: CSS, Html, Html5, Javascript, Php
      Number of Javascript: 10
      Number of meta tags: 4
    2. CottonCandy Design Studio.
      Check out this GoDaddy hosted webpage! http://cottoncandydesign.com.
      Scottsdale (United States) - 97.74.42.79
      Server software: Microsoft-IIS/7.0
      Technology: CSS, Html, Javascript, jQuery, jQuery UI
      Number of Javascript: 4
      Number of meta tags: 3
    3. gckrt.win
      Austin (United States) - 209.99.40.227
      Server software: Apache
      Technology: Html
      Number of meta tags: 2
    4. dcixtl.cn
      Walnut (United States) - 104.217.72.157
      Server software: Microsoft-IIS/7.5
      Technology: CSS, Html, Php, SVG
      Number of Javascript: 2
      Number of meta tags: 3
    5. enobo.us – Elke and Oliver's Blog
      Chicago (United States) - 181.224.138.25
      Server software: nginx
      Technology: CSS, Google Font API, Gravatar, Html, Html5, Javascript, jQuery, Php, Pingback, WordPress Stats, Wordpress
      Number of Javascript: 10
      Number of meta tags: 4
    6. virgingalacticspaceflightsystems.biz
      United States - 208.91.197.27
      Server software: Apache
      Technology: Html
      Number of meta tags: 2
    7. ICE COLD LOVE.COM | The Legendary – ICE COLD LOVE Website
      Houston (United States) - 192.185.13.242
      Server software: nginx/1.10.1
      Technology: CSS, Html, Html5, Javascript, jQuery, MediaElement, Php, Pingback, Wordpress
      Number of Javascript: 6
      Number of meta tags: 3
    8. PC Repair & Services, Houston, 77070
      PC Parts and Service handles all types of computers from preventive maintenance to data recovery. Customer satisfaction, trust, and privacy concerns are my number one priority.
      Scottsdale (United States) - 97.74.215.25
      Server software: Apache
      Technology: CSS, Html, Javascript, jQuery, Php
      Number of Javascript: 4
      Number of meta tags: 7
    9. Home
      Wayne (United States) - 74.208.86.136
      Server software: Apache
      Technology: CSS, Html, Html5, Javascript, Php
      Number of Javascript: 7
      Number of meta tags: 4
    10. Miami Christmas Cards - Order Miami Greeting Cards Online
      Miami Christmas Cards - order personalized holiday cards online - florida tropical themes including Miami, beaches and palmtrees.
      Metairie (United States) - 199.7.108.208
      Server software: Apache/2.2.29 (Unix) mod_ssl/2.2.29 OpenSSL/1.0.1e-fips DAV/2 mod_bwlimited/1.4 mod_perl/2.0.8 Perl/v5.10.1
      Technology: CSS
      Number of meta tags: 4

    Check Other Websites